<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4129 4129-30318 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N Y181V   K43E, E44A, V118I, K122KE, I142V, K166R, V179I, T200M, E203K, Q207D, H208Y, R211K, K223E, L228LH, A272P, K277R, K281R, I293IV, E297K, S322T, I326V, G333E, Q334N, G335C, M357V, G359S, V365I, A371V N137H
>4129-30318| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINHETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIII
VQYVDDLYVGSDLEIGQHRMKIKELRDYLWKWGFYTPDNKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQENCQWTYQIYQEPFKNLKTGKYARVRSA
HTNDIKQLTEVVQKIATESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L33F, F53FL, Q58E, T74P L10I, V11L, I13V, K20R, E34Q, E35D, M36I, K55KR, L63P, A71V, I72V, V77I, I93L R41Q
>4129-30318| codons 1-99
PQITLWQRPILTVKIGGQLREALLDTGADDTIFQDINLPGQWKPKIVGGIGGLLRVREYD
QIPIEICGHKVVGPVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006