<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4126 4126-30326 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, L210W, T215Y   K103N, Y181YC, Y188Y*FL A98G, V108VI S68G, D121H, K122E, S162SA, E203K, Q207E, R211K, K223KE, L228H, K277KR, E297A, E312EQ, I329L, Q334E, G359T, S379C  
>4126-30326| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYMDDLLVGSDLEIGQHRTKIKELREHLWKWGFYTPDKKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKQPVHGVYYDPSKDLIAELQKQGEGQWTYQIYQEPFKNLKTGKYARMRTA
HTNDVKQLTEAVQKIATECIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M   K20I, E35D, M36I, R57K, D60E, I62V, L63P, I64V, A71V, P79AS, I93L, T96TP  
>4126-30326| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFLKVKQYE
QVPVEICGHKVIGTVLVGSTPVNVIGRNLMTQLGCPLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006