<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4118 4118-30407 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MIL, I54V, I84V, L90M L10F, V11VI, L33F, G73GS, T74TP T4A, I13V, K20R, E35D, M36I, N37S, R41K, R57RK, I62IV, L63P, K70E, A71V, I72IV, P79PA, I93L  
>4118-30407| codons 1-99
PQIALWQRPFITVKIGGQLREALLDTGADDTVFEDISLPGKWKPKLIGGIGGFVKVKQYD
QVPIEICGHEVVSPVLVGATPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, K70N, V75I, F77L, F116Y K103N V108I, P225H K43E, T58N, K122KE, D123DE, I135T, S163A, I178M, T200A, R211K, L228H, I326V, Q334L, V365I, T386IV, K390R, E399G, A400S F214M
>4118-30407| codons 1-401
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEEEGKISKIGPENPYNNPV
FVIKKKDSTNWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAFYSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSAMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGMTTPDKKHQKEHPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDIKQLTEAVQKIATESIVIWGKVPKFRLPIQKETWGSW

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006