<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4081 4081-30228 Germany 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V   L10V, I13A, K14R, K20I, A22V, E35D, M36I, N37S, R41K, Q61H, I66F, H69K, K70R, P79S, L89I, T91TS  
>4081-30228| codons 1-99
PQITLWQRPVVTARIGGQLIEVLLDTGADDTVLEDISLPGKWKPKLIGGIGGFVKVRQYD
HILIEFCGKRAIGTVLVGSTPVNVIGRNILSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219Q     V35T, T39L, D123E, I135V, A158AS, S162A, K173T, Q174A, D177E, T200A, Q207E, D218E, V245Q, T286A, E291D, V292I, I293V, P294T, S322T, I326V, G335D, R356K, M357K, G359S, T369V, A371V, I375V, A376S, K390R, K395R  
>4081-30228| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRTANPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLVEVVQKVSTESIVIWGKTPKFRLPIQRETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006