<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4080 4080-30227 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, V82A L10F, K43T, M46V I13V, G16A, K20M, E35E_E, I64V, A71V  
>4080-30227| codons 1-99
PQITLWQRPFVTVKIAGQLMEALLDTGADDTILEEMNLPGRWTPKVVGGIGGFMKVRQYD
QILVEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75M, F77L     E6D, V35T, A98S, D123E, I135T, D177N, T200A, K223KQ, L228K, A272G, I293V, E297Q, Q334N, A360V, I375V, K390R  
>4080-30227| codons 1-400
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDLRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPDKKHQQEPPFKWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGTKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNGQWTYQIYQEPFKNLKTGKYARMRGV
HTNDVKQLTEAVQKVATESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006