<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4077 4077-30225 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84IV, L90M L33F, F53L, Q58E, G73GS L10I, K20R, E35D, M36I, N37ND, R41RK, K55R, I62V, L63P, I66V, A71V, I72IT, Q92K, I93IL, C95FL  
>4077-30225| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFEDIDLPGKWKPKLIGGIGGLVRVREYD
QVPIEVCGHKVTSTVLVGPTPANVIGRNLMTKLGLTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y V75T, K219E K101E, Y181C, G190A V108I T39TA, V118I, K122E, Q174R, T200A, E203K, Q207DE, R211K, D218E, L228NS, Q278H, T286P, I293V, E297R, K311R, I329V, Q334L, G359S, A371V, A376CS, T377L  
>4077-30225| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKITDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
CQYVDDLYVASDLEIGQHRAKIKELREHLWKWGFYTPEEKHQKEPPFSWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGPKALTEVVPLTREAE
LELAENREILREPVHGVYYDPSKDLIAEVQKQGLGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKISLESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006