<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4075 4075-30220 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, L90M L33F, M46V, G73T L10I, E34Q, L63P, C67F, H69Q, A71IT, I72V, V75I, V77I  
>4075-30220| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTIFQEMNLPGRWKPKVVGGIGGFMKVRQYD
QIPIEIFGQKTVTTILIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_VT, L74LV, T215Y D67E Y181IV, G190A   K20R, V35E, K64KR, K101Q, K122E, I135L, T139R, I142T, V179I, E224D, V245K, L283I, T286P, A288S, I293V, E297R, K366R, A376C, T386I, K390R  
>4075-30220| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALEEICTELEKEGKISKIGPENPYNTPV
FAIRKKESTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNERPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
VQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKDPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGPKSLTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVRQLTEAVQKICTESIVIWGKIPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006