<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2083 CA7711 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 104
2 AZT+ 3TC+ SQV 17
3 AZT+ 3TC+ IDV 24
4 DDI+ D4T+ IDV 35
5 3TC+ D4T+ NVP 23
6 DLV+ SQV+ NFV 29
7 DLV+ D4T+ IDV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73C L10I, K20I, D60E, L63Q, I64V, V77I, I85V  
>CA7711| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYE
QIQVEICGHKAICTVLIGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N, Y181YC V108VI, K238KT V35VI, K43N, E44D, S48E, V118I, K122P, K166R, D177E, G196E, R211K, H221HY, V245E, A272P  
>CA7710| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELENDGKIEKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKYQKEPPFLWMGYELHPDTWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGI

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005