<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4066 4066-30326 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_CA, L74V, L210W, T215Y D67S, N348I K103H, Y181C, G190A   K20R, V35I, A98S, K122E, I135T, G196E, T200A, Q207E, L228H, P294T, A376S, K390R  
>4066-30326| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKSSSKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKHKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIEQHRAKIEELREHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVITLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARMRGA
HTNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10F, L33F, G73S T4P, K14R, I15V, M36L, N37D, I62V, L63P, A71V, I72M  
>4066-30326| codons 1-99
PQIPLWQRPFVTIRVGGQLKEALLDTGADDTVFEELDLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVMSTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006