<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4058 4058-30311 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L24I, Q58E, N83D L10I, I13IV, K20R, A22V, E35D, M36I, N37Q, I62V, L63P, I64V, A71V, I72V, T91S, I93L  
>4058-30311| codons 1-99
PQITLWQRPIVTVKIGGQLREVLIDTGADDTVLEDIQLPGRWKPKIIGGIGGFVKVREYD
QVPVEICGHKVVGTVLVGPTPVDVIGRNLLSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y N348I     V35IM, T39A, K43E, K49KQ, W88CS, V118I, I202V, E203D, R211K, I293V, I329V, Q334E, K390R  
>4058-30311| codons 1-398
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEEGKISQIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVDELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEGQWTYQIYQEPFKILKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETW

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006