<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4055 4055-30303 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82T, I84V L24I L10I, I13V, K20M, E35D, M36I, L63P, A71V, I72V  
>4055-30303| codons 1-99
PQITLWQRPIVTVKIGGQLMEALIDTGADDTVLEDINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVVGTVLVGPTPTNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75M, F77L K103N A98G V35M, K43N, V118I, K122E, D123G, E169D, R211K, L228R, I293V, D324E, I326V, R358K, G359GS, K390R  
>4055-30303| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDLRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELVAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006