<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4052 4052-30218 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, T215Y   K103NS, Y188L   V35T, T39A, K43Q, K102E, V118I, D177E, Q207E, R211K, V245K, A272P, V276I, L283I, A288T, I293V, E297K, L301I, I309IV, Q334E, V365I, K390R, I393V, K395R, E399D D237A
>4052-30218| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEQEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKESKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLLVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPAKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKTLTEVVPLTKEAE
IELAENREVLKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDIKQLTEAVQKIATESIVIWGKTPKFRLPVQRETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I, L33F L10I, G16E, K20R, M36I, N37D, K45V, R57K, I62V, L63R, C67Y, K70T, L89M  
>4052-30218| codons 1-99
PQITLWQRPIVTIKIEGQLREALIDTGADDTVFEEIDLPGRWKPVMIGGIGGFVKVKQYD
QVRIEIYGHTAIGTVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006