<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4047 4047-30625 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184I, T215F D67G, K219Q Y181C A98G, V108I, V179E, F227L K20R, V35T, K64H, T69N, W88C, K103R, V118I, K122E, D123N, S162SDGN, I178L, T200A, E203K, Q207E, F214L, K223E, V245VE, A272P, K277R, I293V, S322T, I329L, Q334E, R358K, A360V, K390R, K395R, E399D  
>4047-30625| codons 2-399
ISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPVF
AIHKKGSNRWRKLVDFRELNKRTQDFCEVQLGIPHPGGLKKRKSVTILDVGDAYFSIPLD
ENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDLEIC
QYIDDLYVGSDLEIGQHRAKIKELREHLLRWGLFTPDQKHQEEPPLLWMGYELHPDKWTV
QPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAEL
ELAENREILKEPVHGVYYDPTKDLIAELQKQGEGQWTYQIYQEPFKNLKTGKYARMKGVH
TNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQRETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V, L90M Q58E, G73S, L89V L10I, V11L, I15V, G16A, K20IT, E21Q, M36MI, R41K, D60E, Q61D, L63P, A71V, I72T, I85V, I93L T91CS
>4047-30625| codons 1-99
PQITLWQRPILTIKVAGQLTQALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVREYE
DIPIEICGHKVTSTVLVGPTPTNVVGRNVMSQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006