<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4046 4046-40304 Germany 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L33F, K43T, N83D T4A, T12P, I13V, K14R, A22V, E34R, M36A, P39Q, D60E, I62V, L63P, H69Y, A71V, T91AS, Q92K, I93L  
>4046-40304| codons 1-99
PQIALWQRPLVPVRIGGQLKEVLLDTGADDTVFREANLQGRWTPKIIGGIGGFVKVRQYE
QVPIEICGYKVIGTVLVGPTPVDVIGRNLLSKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, Q151M, M184V A62V, D67T, T69G, V75I, F77L, F116Y, K219R K103N, Y181C   V35T, W88S, V118I, K122E, I135T, E138EG, I202V, R211K, F214L, V245E, A272P, K277R, I293V, T296S, E297K, I329L, M357T, V365I, A376T, T377L, T386A, K390R, E399D  
>4046-40304| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FVIKRKTSGKWRKLIDLRELNKRTQDFSEVQLGIPHPAGLKKNKSVTVLDVGDAFYSIPL
DEDFRKYTAFTIPSTNNGTPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGLTTPDRKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLSKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDIKQLTEAVQKITLESIVIWGKAPKFRLPIQKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006