<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2081 CA7705 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 56
2 AZT+DDC 52
3 3TC+AZT+SQV 17
4 3TC+AZT+IDV 43
5 3TC+D4T+NFV 21
6 3TC+D4T+DDI+NVP 54

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82VA, L90M L33LI, G73S L10I, K20MV, E35D, M36I, N37D, I62V, L63P, A71V, I72IL  
>CA7705| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVIEDIDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y K219KR K103KN, V106VA, G190GA F227FL K20KR, T39TK, K43E, E44AD, W88C, K102Q, V118I, K122E, G196E, E203DV, Q207E, H208Y, R211K, H221HY, I293IV, E297Q N54I
>CA7704| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICKELEEAGKISKIGPEIPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKQNKSATVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIEQHRTKIDELREYLWKWGFYTPDRKYQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTQEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005