<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4031 4031-30305 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, L210W, T215Y K219E K103N V108I V35IM, T39A, S68G, V118I, K122E, D123N, I135T, I142IV, D177DG, T200TA, E203K, Q207E, R211K, D218E, K223T, L228H, R284K, T286A, A288T, E297R, D324E, I326IM, I329L, M357MI, A360V, A376AT, S379C, E399D P4PHNT
>4031-30305| codons 1-399
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKNGTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLWKWGFYTPEEKHQTEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKTLTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKELMAELQKQGQGQWTYQIYQEPFKNLKTGKYARIRGV
HTNDVKQLTEAVQKITTECIVIWGKTPKFKLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MIL, I50IV, I54V, V82A, L90LM L10FI, L24LI, L33LF, F53FL, G73GS T4TP, I13IV, K14KR, I15V, Q18QH, K20R, E35D, M36I, N37E, R41K, I62IV, L63P, A71IT, I72IM, I85IV  
>4031-30305| codons 1-99
PQIPLWQRPIVTVRVGGHLREALIDTGADDTVFEDIELPGKWKPKLIGGVGGLVKVRQYD
QVPIEICGHKTMSTVLVGPTPANIVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006