<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4012 4012-30414 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I K219Q K103N, Y181YC, G190A   K20R, V35I, T39TS, K64H, T69N, K122E, D123DN, I178IL, T200A, E203K, Q207E, H208Y, L228H, A272P, I293V, E297K, I329V, G333E, Q334P, R356K, A360T, K366KR, I375IV, T386I, E399D  
>4012-30414| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICSEMEKEGKISKIGPENPYNTPV
FAIHKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
CQYMDDLYVASDLEIGQHRAKIKELREYLLRWGFTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQEPGQWTYQIYQEPFKNLKTGKYAKMRGT
HTNDVRQLTEAVQKVATESIVIWGKIPKFKLPIQKETWDA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36T, N37D, R57K, I62V, L63P, A71V, I93L  
>4012-30414| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDTDLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006