<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1430 CA7699 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 65
2 DDI 121
3 D4T 95
4 3TC+D4T+SQV 30
5 3TC+D4T+NVP+SQV 8
6 3TC+D4T+NFV 84

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   E35D, M36I, I62V, L63H, A71AT  
>CA7699| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVHIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       R83K, Q207E, V245R, T286A, E297K K259K*, V261VA
>CA7698| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIRLPEKDSWTVNDIQ*LAGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005