<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-4007 4007-30327 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y V75M, K219D K101E, Y181C, G190S   V35T, T39ALSV, E44D, V60I, K82KR, V118I, K122E, I135M, S162SN, H208HY, D218E, L228H, A272P, K277R, L283LI, I293V, E297A, I326V, R356K, G359S, T386I, K390R  
>4007-30327| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICVELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNRRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIVI
CQYMDDLYVSSDLEIGQHRTKIEELRQYLWRWGFYTPEDKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50V, I54V, V82A, L90M F53L L10V, I15V, K20R, E34Q, E35D, M36V, N37E, I62V, L63P, A71L, V77L, I93L  
>4007-30327| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTILQDVELPGRWKPKIVGGVGGLVKVRQYD
QVPIEICGHKLIGTVLLGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006