<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3327 3327-30917 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   L10LV, I13IV, L19I, I62IV, L63A, I64IV, T74K, V77I, I93L  
>3327-30917| codons 1-99
PQITLWQRPVVTVKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVAVEICGHKAIGKVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V N348I Y181YC   V21I, K49R, I135T, T200A, K201KR, I202V, R211Q, F214FL, L228LR, V245KM, A272AP, K277R, R284K, T286A, Q334Y  
>3327-30917| codons 1-399
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRARVEELRQHLLQWGLTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLKGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGYGQWTYQIYQEPFKILKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006