<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3313 3313-30929 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A, L90M V11I, L33F, K43T L10I, I13V, L19T, K20KR, Q61E, I62V, L63P, A71L, I72IT, V77I, I93L  
>3313-30929| codons 1-99
PQITLWQRPIITVKIGGQTREALLDTGADDTVFEEMNLPGRWTPKMIVGIGGFTKVRQYD
EVPIEICGHKLTGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70G, L210W, T215Y K219Q Y188L   I2V, P4S, V35M, T39TA, E44ED, V106VI, I135T, K173E, I178IM, V179I, G196E, E203K, Q207E, H208Y, R211K, D218E, A272P, V317A, Q334IV, R356K, M357LS, G359S, E370ED, A371AV, K390R  
>3313-30929| codons 1-400
PVSSIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDMII
YQYMDDLLVGSDLEIEQHRTKIKELREYLWKWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGVGQWTYQIYQEPFKNLKTGKYAKSRSA
HTNDVKQLTDVVQKIATESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006