<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3309 3309-30902 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   G190A K101H P4S, K20R, E28EK, V35I, K43E, E44A, A98S, V118I, K122E, I142V, Q174R, T200A, E203D, Q207E, H208Y, R211K, K223Q, L228H, V245E, S251H, A272P, K277R, T286A, V292I, I293V, E297R, I329IV, G333E, G359S, S379C, K390R W212Q
>3309-30902| codons 1-400
PISSIETVPVKLKPGMDGPRVKQWPLTKEKIKALIEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYVDDLYVASDLEIGQHRAKIDELREYLWKQGFYTPDKKHQQEPPFHWMGYELHPDKWT
VQPIELPEKDHWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQEQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATECIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47V, G48MV, I54V, V82C, L90M L33F, K43T, G73AT, L89V L10IV, E35D, M36I, Q61QE, I62V, L63P, A71T, I72IT, I93L  
>3309-30902| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVFEDINLPGRWTPKMVVGIGGFVKVRQYD
EVPIEICGHKTTTTVLVGPTPCNIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006