<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1426 CA7692 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 AZT+D4T+SQV 30
3 3TC+D4T+IDV 83
4 D4T+DDC+NFV 29
5 DDI+RTV+SQV 8
6 DDC+RTV+SQV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10LI, K20I, N37A, R41K, I62V, L63P, A71V, V77I, I93L  
>CA7692| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMALPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V60I, T69N, K122KE, I135V, G196E, D218E, V245T  
>CA7691| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWT

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005