<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3296 3296-40226 France 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M K43T, G73S, L89V L10V, T12P, I15V, L19P, K20M, E34Q, M36A, K55R, R57K, D60E, I62V, L63P, H69K, A71I, I93M, C95L  
>3296-40226| codons 1-99
PQITLWQRPVVPIKVGGQPMEALLDTGADDTVLQEANLPGRWTPKIIGGIGGFVRVKQYE
QVPIEICGKKIISTVLVGPTPANVIGRNVMTQMGLTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Y115YF, Q151M, M184MV A62V, V75I, F77L, F116Y, T215TI, K219Q Y181C, G190A A98G, V108VI V35I, T39A, K43Q, T69N, K101Q, D123E, T139TA, S162C, R172RK, D177E, T200TAIV, E203D, D218E, L228HQR, A272P, K281R, I293V, E297Q, G359S, A360T, A371T, T386I V179ILPT
>3296-40226| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEQEGKISKIGPENPYNTPV
FVIKKKNSNRWRKLIDLRELNKRTQDFWEVQLGIPHPGGLQKKKSVTILDVGDAFYSVPL
DKEFRKYTAFTIPSINNEAPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFKKQNPEITI
CQYVDDLYVASDLEIGQHRVKIDELRQHLLRWGFITPEQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRST
HTNDVKQLTETVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006