<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3296 3296-30728 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M K43T, G73S L10V, T12K, I15V, L19P, K20M, E34EQ, M36LV, L38W, K55R, R57K, I62V, L63P, H69K, A71L, I93M, C95L  
>3296-30728| codons 1-99
PQITLWQRPVVKIKVGGQPMEALLDTGADDTVLQEVNWPGRWTPKIIGGIGGFVRVKQYD
QVPIEICGKKLISTVLVGPTPANIIGRNLMTQMGLTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M A62V, V75I, F77L, F116Y, T215TI, K219Q Y181C, G190GA A98G, V108VI P4PT, I5IV, V35VI, T39A, K43Q, T69N, K101Q, D123E, T139TA, S162CY, R172RK, D177E, V179X, V189VI, T200TI, E203ED, D218E, L228LHQ, A272P, K281R, I293V, E297Q, V317VA, G359S, A360T, A371T, T386I  
>3296-30728| codons 1-399
PISTVETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEQEGKISKIGPENPYNTPV
FVIKKKNSNRWRKLIDLRELNKRTQDFWEVQLGIPHPGGLQKKKSVTILDVGDAYYSVPL
DKEFRKYTAFTIPSINNEAPGIRYQYNVLPMGWKGSPAIFQYSMTKILEPFKKQNPEIXI
CQYMDDLYIASDLEIGQHRIKIDELRQHLLRWGFITPEQKHQKEPPFQWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTQEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRST
HTNDVKQLTETVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006