<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3283 3283-30916 France 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, I84V G73A, L89V L10I, I13A, K14KR, L19LI, K20I, L33V, M36I, R41K, K55R, R57RK, D60E, L63P, I66F, H69K  
>3283-30916| codons 1-99
PQITLWQRPIVTARIGGQIIEALLDTGADDTVVEEINLPGKWKPKIIGGIGGFMRVKQYE
QIPIEFCGKKAIATVVVGPTPVNVIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_VA, M184V A62AV     E28K, K32E, V35T, E36A, T39K, K43E, S68RT, K122E, D123S, I142V, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, T286A, E291D, V292I, I293V, P294T, S322ST, D324DE, I326V, G335D, R356K, M357K, G359S, A371V, I375V, A376S, K390R  
>3283-30916| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTAICKELEEEGKISKIGPENPYNTPV
FVIKKKDTSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKELVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVSTESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006