<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3277 3277-30731 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, T215F K219Q, N348I K103N, Y181C   P4PS, T7TP, T39A, V60VI, V90I, V118I, K122P, I135IV, I142V, A158S, T165I, D177E, I178L, F214L, D218E, L228H, A272P, K277R, T286A, E297A, R358K, A376T  
>3277-30731| codons 1-398
PISSIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPSIFQSSMIKILEPFRKQNPELVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARMKGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, Q58E, G73A I13M, L19I, K20I, M36MI, K55R, D60E, L63P, I64V, A71T, I72L  
>3277-30731| codons 1-99
PQITLWQRPFVTMKIGGQIIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVRVREYE
QIPVEICGHKTLATVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006