<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2077 CA7687 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 91
2 DDC+NNRTI 35
3 D4T+DDI+IDV 133

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N, G190S   V35I, K43Q, K122E, I135V, A158AS, R211K, V245K  
>CA7687| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, I15V, E35D, M36I, N37D, R57RK, D60E, Q61E, I62V, L63P, A71V, I93L  
>CA7688| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVKQYE
EVPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001