<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3269 3269-30701 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D N37C, K45R, R57K, L63P, V77I, I85V  
>3269-30701| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMCLPGRWKPRMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLIGPTPVNIVGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215TS     E6K, K122E, I135L, S162C, P176S, T200A, I202V, Q207E, V245T, A272P, K277R, T286A, I293V, E297A, I329V, R358K  
>3269-30701| codons 1-400
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNSDIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLRWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006