<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2075 CA7684 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 75
2 DDI 45
3 DDC 40
4 3TC+AZT+IDV 79
5 3TC+DDC+NFV 26
6 3TC+RTV+SQV 2
7 D4T+DLV+SQV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   L10I, K20M, E35D, M36I, N37K, R41K, L63P, A71T, I93L  
>CA7684| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEDIKLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005