<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3259 3259-30813 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L, V82A, L90M L10F, L33F, N88D I3V, I13V, K20R, E35D, M36I, N37D, I62V, L63P, I72IM  
>3259-30813| codons 1-99
PQVTLWQRPFVTVKIGGQLREALLDTGADNTVFEDIDLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAMGTVLVGPTPANIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       T39A, K122E, I142V, R284RK, I293V, E297K, E312EQ, V317VA, I329L, M357T  
>3259-30813| codons 2-399
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
EDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTKEAEL
ELAENREILKQPVHGAYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARTRGAH
TNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006