<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3250 3250-30627 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N, Y181C A98G, V108I K20R, T39K, K43E, E44D, S68G, R83RK, V118I, K122E, S162A, T200A, E203K, Q207E, R211K, K223Q, L228R, I244IV, K281R, A288S, I293V, P294T, E297K, G333E, G359GS, K366R, T369V, E370D, A371V, I375V, K390R  
>3250-30627| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICKELEEDGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKKTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRAKIKELREHLWKWGFYTPDKKHQQEPPFRWMGYELHPDKWT
VQPVVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKSLTEVVTLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVRQLVDVVQKVATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33IV, F53FL, G73S, L89V L10V, V11L, I13V, K20M, A22V, M36I, R41K, K55KR, D60E, Q61N, I62V, L63P, A71I, I72T, I93L  
>3250-30627| codons 1-99
PQITLWQRPVLTVKIGGQLMEVLLDTGADDTVVEEINLPGKWKPKMIGGIGGLVRVRQYE
NVPIEICGHKITSTVLVGPTPANIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006