<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3249 3249-30617 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, I84V Q58E L10I, I15V, K20R, M36I, I62V, L63P, Q92R, I93L  
>3249-30617| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEEINLPGRWKPKLIGGIGGFLKVREYD
QVPIEICGHKAIGTVLVGPTPVNVIGRNLLTRLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q, N348I K103N K238T V60I, V118I, D121Y, K122E, I142T, R172K, Q174R, I178L, Q207E, F214L, L228H, T286A, E297A, Q334H, T338S, M357T  
>3249-30617| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKRNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLFTPDQKHQKEPPFHWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHGQWSYQIYQEPFKILKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006