<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3246 3246-30616 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L33F, Q58E L10IV, I13V, I15V, L19I, K20R, E35D, M36I, K55KR, R57K, L63P, K70KT, A71V, I93L  
>3246-30616| codons 1-99
PQITLWQRPVVTVKVGGQIREALLDTGADDTVFEDINLPGRWKPKIIGGVGGFVRVKEYD
QIPIEICGHTVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML       P4PS, T39A, K122KE, Q174QK, G196GR, H208HY, V245I, A272S, K277R, T286A, E297A, E312AT, I329L, M357T, R358K, A376T, T386M, K390R  
>3246-30616| codons 1-399
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYMDDLYVGSDLEIRQHRTKIEELRQYLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTEVIPLTAEAE
LELAENREILKTPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKITTESIVIWGKMPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006