<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3241 3241-30604 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74IV, M184V, T215Y     A98G V35M, E53ED, R83RK, V118VI, K122KE, D123E, S162H, R211KT, A272P, K281R, P294T, E297R, F346Y, R358K, E399D  
>3241-30604| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKIGPDNPYNTPV
FAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLTWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVITLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, N37D, D60E, L63P, A71V, V77I  
>3241-30604| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKLIGGIGGFVKVRQYE
QIPIEICGHKVIGTVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006