<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3236 3236-30526 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54LV, V82F, L90M L33F, Q58E L10V, I13V, I15V, G16E, K20R, E35D, M36I, R41RK, I62V, L63C, I64V, V77VI, I93L K55Q
>3236-30526| codons 1-99
PQITLWQRPVVTVKVEGQLREALLDTGADDTVFEDINLPGKWKPKMIGGIGGFVQVREYD
QVCVEICGHKAIGTVLIGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, V75M, L210W, T215Y K219Q Y181YC, G190GA   V35T, V60I, K101Q, K122KE, I135V, S162D, E203K, Q207D, H208Y, R211K, D218E, H221HY, L228H, A288S, I293V, L325I, I326V, Q334E, V365I, E370G, S379C, I382L, K395R, E399D  
>3236-30526| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIKELRDYLWKWGFYTPEQKYQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDIVAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDIKQLTGAVQKIATECIVLWGKTPKFKLPIQRETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006