<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3234 3234-30528 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54T, V82A, L90M L33F, K43T L10I, T12P, K14R, K20M, E34Q, E35D, M36I, N37D, I62V, L63P, I64V, A71T, I72IV, I93L  
>3234-30528| codons 1-99
PQITLWQRPIVPIRIGGQLMEALLDTGADDTVFQDIDLPGRWTPKLIVGIGGFTKVRQYD
QVPVEICGHKTVGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LIV, M184V, L210W, T215Y       T39A, K43KE, V118I, K122E, I135T, V179VI, E203K, Q207E, T286A, A288S, K311R, V317VE, S322T, G335GC, M357T, V365I, T386I  
>3234-30528| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIKELREHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKSLTEVIPLTEEAE
LELAENREILREPVHGEYYDPTKDLIAEIQKQGQCQWTYQIYQEPFKNLKTGKYARTRGA
HTNDIKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006