<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3231 3231-30520 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82A, L90M L33F, K43T, F53L, G73S L10V, I13V, G16A, K20R, E35D, M36I, R57RK, I62V, L63P, I66V, A71V  
>3231-30520| codons 1-99
PQITLWQRPVVTVKIAGQLREALLDTGADDTIFEDINLPGRWTPKIVGGIGGLLKVKQYD
QVPIEVCGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69~, L74V, M184V, T215Y K219E L100I, Y188L   T39S, S68G, K122E, E138A, S162C, S163I, Q197K, R211K, D218E, V245M, A272P, R284K, T286P, E297R, I326V, Q334E, M357T, R358K, T377K, E399D  
>3231-30520| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEKEGKISKIGPENPYNTPV
FAIKKKNG~KWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCIMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGKHRTKIEELRQHLLKWGFYTPEEKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGPKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGEGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKIAKESIVIWGKTPKFKLPIQKETWDA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006