<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3227 3227-30521 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67S, K219E K101E, Y181C, G190A A98G, V108I P4T, E28A, K64R, T69N, V179I, R211K, L228S, T286A, I293IV, Q334L, R358K, T369V, T377Q, K385R, K390R  
>3227-30521| codons 1-400
PISTIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKSSNRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFSWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLVEAVQKIAQESIVIWGRTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, G48M, I54M, V82A, L90M L33F, F53L L10I, I13V, Q18H, L19T, K20KT, M36MI, N37S, L63P, A71V, I93L, C95F  
>3227-30521| codons 1-99
PQITLWQRPIVTVKIGGHTTEALLDTGADDTIFEEISLPGRWKPKMVMGIGGLMKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006