<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3220 3220-30519 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103N P225H T39A, I135L, E138A, I142V, Q174R, T200A, R211K, T286A, E297K, K311R, R356K, K390R, I393M, A400AT  
>3220-30519| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNATPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFYTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPMQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13IV, E34ED, E35D, M36I, L63P, I72IV  
>3220-30519| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLDDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006