<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3209 3209-30519 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I, L33F, K43T, F53L, N83D L10I, L19I, K20R, E35D, M36L, N37D, R41K, R57K, I62V, L63P, A71V  
>3209-30519| codons 1-99
PQITLWQRPIVTIKIGGQIREALIDTGADDTVFEDLDLPGKWTPKMIGGIGGLVKVKQYD
QVPIEICGHKVIGTVLVGPTPADIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, T215Y A62V     E6D, V118I, R172K, Q174R, Q207E, R211K, L228H, V245Q, A272P, K281R, L283I, I293V, E297R, V317A, S322T, I329V, G333E, R356K, G359S, A371V, A376T, T386A, K390R  
>3209-30519| codons 1-399
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSGKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKRNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLIRGTKALTEVVPLTREAE
LELAENREILKEPVHGAYYDPTKDLIAEVQKQEQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEVVQKITTESIVIWGKAPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006