<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3206 3206-30512 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A, L90M L33LF L10I, G16A, K20R, M36I, N37D, I62V, L63P, A71V, I72V, I93L  
>3206-30512| codons 1-99
PQITLWQRPIVTIKIAGQLREALLDTGADDTVFEEIDLPGRWKPKLIVGIGGFSKVRQYD
QVPIEICGHKVVGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74I, M184V, T215F V75T, K219Q Y181C, G190S A98G E6D, K43NS, V118I, K122E, V179T, F214L, D218E, L228H, V245M, T286A, E297K, K311KR, I329L, K350R, R356K, M357T, A376T, T386A, K390R  
>3206-30512| codons 1-398
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELESEGKISKIGPENPYNTPV
FAIKKKNSDRWRKITDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDITI
CQYVDDLYVSSDLEIGQHRTKIEELRQHLLRWGLFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLRTGKYAKTRGA
HTNDVKQLTEAVQKITTESIVIWGKAPKFRLPIQKETW

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006