<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3205 3205-30612 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M Q58E L10I, L19Q, K20R, L24F, E35D, M36I, R41K, R57RK, D60X, I62V, L63P, A71V, I93L  
>3205-30612| codons 1-99
PQITLWQRPIVTIKIGGQQREALFDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVKEYX
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   Y188L   V35M, T39A, K43E, K101KQ, V106VI, K122E, R211K, V245K, T286A, I293V, T296S, E297K, I329L, E344D, M357T, V365VI, K385R  
>3205-30612| codons 1-398
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLSKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQDPFKNLKTGKYARTRGA
HTNDIKQLTEAVQKIATESIVIWGRTPKFKLPIQKETW

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006