<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3197 3197-30507 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82C, I84V, L90M L10F, L33F, G73T L19I, E34Q, R41K, L63P, A71V, I93L  
>3197-30507| codons 1-99
PQITLWQRPFVTIKIGGQIKEALLDTGADDTVFQEMNLPGKWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVITTVLVGPTPCNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DE, K70KR, Q151M, M184V A62V, V75I, F116Y, T215V, K219Q Y181I, G190A V108VI, V179E K20R, T27S, E28A, K32KQ, V60I, R83K, K103KR, V118I, K122E, I135V, K173E, I202V, F214L, E224D, L228H, V245M, D250S, A272P, K277R, Q278E, L283I, A288T, I293V, E297Q, G335D, R356K, G359S, T386I, K390R E138V, L209LM, L325L*
>3197-30507| codons 2-399
ISPIETVPVKLKPGMDGPRVKQWPLSAEKIQALVEICTEMEKEGKISKIGPENPYNTPIF
VIKKKNSERWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTILDVGDAYYSIPLD
EDFRKYTAFTIPSVNNVTPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFREQNPDIEII
QYVDDLYVASDLEIGQHRTKVEELRQHMLRWGLVTPDQKHQKDPPFHWMGYELHPDKWTV
QPIMLPEKSSWTVNDIQKLVGKLNWASQIYPGIKVRELCKLIRGTKTLTEVVPLTQEAEL
ELAENREILKEPVHGVYYDPSKD*IAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRSAH
TNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006