<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3189 3189-40401 France 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, L76V, V82A, L90M K43T L10V, I15V, N37D, K55R, R57K, D60E, I62V, L63P, H69R, A71V, L89M, I93L  
>3189-40401| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEEMDLPGRWTPKIVGGIGGFMRVKQYE
QVPIEICGRKVIGTVVVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, T215F K219Q K101P, K103N   E6K, V118I, K122E, I135T, Q174H, Q197E, T200A, R211T, F214L, D218E, V245A, E248ED, A272P, I293V, E297K, V317A, G333E, Q334Y, M357T, T386I  
>3189-40401| codons 1-399
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIGEHRAKIEELRQHLLTWGLFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIALPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQEYGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006