<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JCSB6 B6W48 Europe 1994 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC NA
2 RTV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I84V L33LF V11VA, E34K, M36I, N37S, A71V D25DE
>B6W48| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILKEISLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKVIGTVLVGPTPVNVIGRNLLTQIGCTLNF

References
Author Title Citation
Schmit, J-C Resistance-related mutations in the HIV-1 protease gene of patients treated for 1 year with the protease inhibitors ritonavir (ABT-538). AIDS, 1996
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005