<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3172 3172-30416 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, L76V, V82F, I84V L33F L10I, I13V, R57RK, I62IV, L63P, I64V, A71V, V77I  
>3172-30416| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVKQYD
QVPVEICGHKVIGTVVIGPTPFNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, T215Y K219E     S48T, V60I, S68G, K122E, R211RK, L228H, S251H, E291D, V292I, I293V, A360AV, K390R  
>3172-30416| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKITKIGPENPYNTPI
FAIKKKNGTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDHWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGV
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006