<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3169 3169-30409 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219N K101E, Y181C, G190A A98G, V108I E6D, V35I, E40F, K43E, W88C, V118I, K122E, T165V, Q174R, G196E, H208Y, R211K, A272P, K277R, I293V, E297A, D324E, G359S, V365I, T369V, T386TI  
>3169-30409| codons 1-399
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHPGGLEKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMVKILEPFRKRNPDIVI
CQYVDDLYVASDLEIEQHRTKIEELRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDIKQLVEAVQKIATESIVIWGKIPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33F, F53L, G73S L10I, Q18H, L19I, K20R, E35D, M36I, N37D, K55R, R57K, L63P, A71V  
>3169-30409| codons 1-99
PQITLWQRPIVTIKIGGHIREALIDTGADDTVFEDIDLPGRWKPKLIGGIGGLVRVKQYD
QIPIEICGHKVISTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006