<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3166 3166-30424 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SG, T215F   Y181C, G190S   P4PS, T7TP, V35E, T39A, K122P, I135T, I142T, P176Q, V179VI, T200A, I202V, R211RK, L228H, A272P, K275R, Q278H, T286TA, I293IV, E297K, Q334E, K366R, A376T, T386A, K390R  
>3166-30424| codons 1-399
PISSIEPVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNQDIII
CQYMDDLYVSSDLEIGQHRAKVEELRQHLLKWGFFTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVRQLTEAVQKITTESIVIWGKAPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V L24I, Q58E L10V, I15V, K20V, E35N, M36I, K55KR, R57K, D60E, I62V, L63P, I64V, I72V, V82I  
>3166-30424| codons 1-99
PQITLWQRPVVTIKVGGQLVEALIDTGADDTVLENINLPGRWKPKIIGGIGGFVRVKEYE
QVPVEICGHKAVGTVVVGPTPINIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006