<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3149 3149-30429 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54IV, V82VA, L90LM K43T, N88ND L10LV, I15V, K20KMR, E35D, M36MI, N37HQ, I62IV, L63P, A71AV, I72T  
>3149-30429| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDIQLPGRWTPKLIGGIGGFVKVRQYD
QVPIEICGHKVTGTVLVGPTPANIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, T69AD, M184MV, L210LW, T215TNSY K219KR     V35IL, T39TA, E44ED, V118VI, F171FY, T200I, E203ED, Q207D, E248D, L283I, I293V, V317VA, I329IV, G359S, A371V, K390R  
>3149-30429| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIDELRDHLWRWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006